pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL) Micelles with Fluorescence and Magnetic Resonance (MR) Dual Imaging Modalities and Drug Delivery Performance

نویسندگان

  • Sidan Tian
  • Guhuan Liu
  • Xiaorui Wang
  • Guoying Zhang
چکیده

The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers). Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL) micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR) dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA), was synthesized via consecutive atom transfer radical polymerization (ATRP), where OEGMA, DPA, and GMA are oligo(ethylene glycol)methyl ether methacrylate, 2-(diisopropylamino)ethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd) (DOTA is 1,4,7,10tetraazacyclododecane-1,4,7,10-tetrakisacetic acid) or benzaldehyde moieties via copper(I)catalyzed alkyne-azide cycloaddition (CuAAC) chemistry, resulting in the formation of DOTA(Gd)-POEGMA-b-P(DPA-co-GMA) and benzaldehyde-POEGMA-b-P(DPA-co-GMA) copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxy)phenyl]ethylene (TPE-4SH), which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT) was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG) moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA(Gd) contrast agents exhibited increased relaxivity (r1 = 16.97 mM ́1 ̈ s ́1) compared to alkynyl-DOTA(Gd) small molecule precursor (r1 = 3.16 mM ́1 ̈ s ́1). Moreover, in vivo MRI (magnetic resonance imaging) measurements revealed CCL micelles with pHLIP peptides exhibiting better tumor accumulation and MR imaging performance as well.

برای دانلود رایگان متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

ثبت نام

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

Multifunctional MIL-S─CUR@FC nanoparticles: a targeted theranostic agent for magnetic resonance imaging and tumor targeted delivery of curcumin

Introduction: Noninvasive magnetic resonance imaging (MRI) and targeted drug delivery systems, usually referred to as theranostic agents, are being developed to enable detection, site-specific treatment, and long-term monitoring.   Materials and Methods: To elucidate the effects of coating on cellular uptake and biodistribution of n...

متن کامل

Iron-gold (Fe2O3@Au) core-shell nano-theranostic for magnetically targeted photothermal therapy under magnetic resonance imaging guidance

Introduction: Photothermal therapy (PTT) is a nanotechnology-assisted cancer hyperthermia approach in which the interaction between laser light and plasmonic nanoparticles generates a localized heating for thermoablation of the tumor. Recent efforts in the area of PTT follow two important aims: (i) exploitation of targeting strategies for preferential accumulation of plasmonic ...

متن کامل

Multifunctional GQDs-Coated Fe/Bi Nanohybrids for CT/MR Dual Imaging and in vitro Photothermal Therapy

Introduction: The multipurpose nanocomposites have gained growing biomedical attention as promising nanotheranostics to improve The effectiveness of cancer treatment, which concurrently combine advantages of the therapeutic and diagnostic techniques into one nanosystem. The “all-in on” probes not only help to ablate cancerous tumors, but also allow to optimize and monitoring of...

متن کامل

A New Theranostic System Based on Gd2O3 NPs coated Polycyclodextrin Functionalized Glucose for Molecular Magnetic Resonance Imaging (MMRI).

Introduction: Recent advances in nanoscience and biomedicine have attracted tremendous attention over the past decade to design and construct multifunctional nanoparticles that combine targeting, therapeutic, and diagnostic functions with a single platform to overcome the problems of conventional techniques for diagnosis and therapy with minimal toxicity.   Materials ...

متن کامل

Versatile pH-response Micelles with High Cell-Penetrating Helical Diblock Copolymers for Photoacoustic Imaging Guided Synergistic Chemo-Photothermal Therapy

With high optical absorption efficiency, near infrared (NIR) dyes have been proposed as theranostic agents for fluorescence imaging, photoacoustic imaging (PAI), and photothermal therapy (PTT). However, inherent hydrophobicity and short circulation time of small molecule hinder the further biomedical application. Herein smart amphiphilic copolymer was synthesized containing IR780/camptothecin@p...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

عنوان ژورنال:

دوره   شماره 

صفحات  -

تاریخ انتشار 2016